PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00182.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TALE
Protein Properties Length: 539aa    MW: 60832.6 Da    PI: 6.6755
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00182.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.6e-094584961854
                              HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  Sme2.5_00182.1_g00005.1 458 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 496
                              5887779******************************88 PP

2BELL72.29e-24334401371
                     BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                              ++ ++kk  L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L+++i++ 
  Sme2.5_00182.1_g00005.1 334 MDCEAKKMNLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-SIHARFALQTISSLYKNLRERISNY 401
                              6789***************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-18277400IPR006563POX domain
PfamPF075266.2E-25283399IPR006563POX domain
PROSITE profilePS5007111.224437500IPR001356Homeobox domain
SMARTSM003895.5E-7440504IPR001356Homeobox domain
CDDcd000861.00E-11440501No hitNo description
SuperFamilySSF466891.2E-15442509IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-26443506IPR009057Homeodomain-like
PfamPF059203.9E-15457496IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MAEPHNIIDE SFLHTNTVPL SFPETVCLNN QNHIMDGENH IMDGNGIPFP FMLQGEAINS  60
SQGFLNLPYF PRAVDTEAIH NVRNRIKEFS VSASYPVGYA YAEGQYMEGI PISAGSLANL  120
LAARNAMHEN LAVLAPVSHP GEGQKIDGLD YPNVLNHSFG SYRNYEFDGV PEIAGMVVGR  180
AGSQPFQLTE NVNSNTWFSS ETASLRSDSP SGSSRFSNEL CLSLTTSQSA VACGATIRDQ  240
CSDISCSGVT NHVFPQRHFD SELTSCNSRN LSSYKPVHLS QFLTGSRYLR VMQEVLSEIA  300
QLSLQNHNMD VGRGYAAMSS DDLPDGDRRI IGQMDCEAKK MNLVALLQVV DDQYNQCLDE  360
IHMVISAFHA VTELDPSIHA RFALQTISSL YKNLRERISN YILMMGENFN KGGVEKSFET  420
SFIQKQWALQ QLKRKDHQLW RPQRGLPERS VSVLRAWMFQ NFLHPYPKDA EKQLLAVKSG  480
LTRSQVSNWF INARVRLWKP MIEEMYAEMS RRKIRTGNED EANHRRNHKI IENHLFTMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B5e-15446503158Homeobox protein Meis1
4xrs_A5e-15446503158Homeobox protein Meis1
3k2a_B8e-15446504563Homeobox protein Meis2
3k2a_A8e-15446504563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0095960.0AP009596.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0092J11, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361000.20.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-100ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-100homeobox gene 1